#foodporn

152,080,952 posts tagged with #foodporn

Photos and Videos about #foodporn

Hoy Domingo 🏆 #copaamerica . Uruguay 🇺🇾 vs Ecuador 🇪🇨 . ⚽️ 5:00 P.M. 💥20% de Descuento a Locales. 🌙🌴🍖🍸🍴🍷🍤🇲🇽. #bites #beat #drink #parizza #amigos #musica #music #mixologia #mixiology #travel #travelfood #deco #decoration #restaurant #bar #travel #travelling #cocktails #foodie #foodporn #shisha #monsoonclub #playadelcarmen #rivieramaya #mexico

Sonntagsdessert... Bananenkuchen mit frischen Erdbeeren und selbstgemachtes Vanilleeis 😋 #eiszeit #vanilleeis #eis #selbstgemacht #lecker #foodporn #food #foodlover

#thebluebowlseries Mediterranean-but-I-added-avocado salad. 500 calories (24g carb, 35g carb, 29g protein) Ingrdients: Mediterranean salad kit from trader Joe's, boiled chicken, avocado, cucumber and 1 tbsp poppy seed dressing . . . . . . . . . . . . . . . #foodpicoftheday #foodgasm #foodpic #foodporn #instafoodgram #instadaily #traderjoes #healthyrecipes #lowcarb #easyrecipes #cleaneating #salad

O' sole, o' mare, o' Vesuvio ❤ #brotherhood #familylove #doctorvisit #foodporn #napoli #vita

@hartstable I love the Buddha Bowl here because it’s a large portion and I can take 1/2 for lunch the next day 😋 this place has excellent summer vibes on the patio and 1/2 price Wine Wednesdays! and they have Truffle popcorn 🍿 +🍷🍾🥂=😍 #yegfood #yegsouthside #food #foodie #yegfoodie #edmonton #edmontoneats #yeg #foodstagram #foodporn

Ba ba ba ba ba ba ba BROWNIES! Place your orders today & for details DM or inbox us. . . . . . #brownies #instadessert #desserts #instabrownie #foodporn #delicious #dessertporn #sweet #tasty #yummy #chocolate #brownietime #foodpics #instafood #desserttime

Weekend Breakfast views in Santorini!🥞☀️🇬🇷 Would you go there? Tag someone you’d have breakfast here with!🥂✨ -------------- Follow us @luxurywrld for daily 🔷 Millionaire Lifestyle and Motivation🔷 Courtesy of - @cbezerraphotos via @tasteinhotels —————- . . . #entrepreneurlife #luxury #travel #lifestyle #mensstyle #baller #millionaire #billionaire #nature #adventure #rich #holiday #vacation #sea #goodlife #trip #travelgram #instatravel #maldives #thebillionairesclub #breakfast #foodporn #foodie #food #pancakes #weekend #greece #poolparty #santorini #visitgreece

GATTINE SONO AL BLANCO. Per foto o autografi non esitate a chiedere poi se scappa un bacio mica lo scanso. SÓ IL VOSTRO GATTONE #chefdubio #ecb #cucina #chef #roma #food #insta #streetfood #life #followme #italia #donnaolimpia #foodporn #instafood #fornelli

(@gweatfood)

1 Minute Ago

Channelling my inner millennial 😄 #foodie #food #breakfast #avocado #avocadotoast #millennial #egg #sausage #foodporn

Liz-hack: When your veggie dog comes with no toppings, stuff it with French fries 🍟🌭 I'm here to watch the Diamondbacks ⚾️ win, but really feels like I just did, go team hot dog👌🙌#frenchfries #win #veggiedog #nationalspark #veganfood #dc #baseballfood #veganhotdogs #diamondbacksbaseball #nom #foodporn #mmm #winning #ilovedc #exploringdc #adventure #lifehack #washingtonnationalsstadium #starwarstheme

tadaaaam !!! kipróbáltam és tökéletes 😍🙂szafi lángos lisztkeverekbol meleg szendvics 🙂🍴🍽🥪növényi sajttal töltve 🙂#szaffi #szaffifree #szaffifitt #healthyfood #healtylife #mutimiteszel #cleareating #foodporn

Compressed melon feta sundried tomatoes quinoa nigella seeds #foodporn#cheflife#feta#watermelon#veggie

Weekend calls for protein. Positive Chicken vibes. The coriander leaves gave that edge. Nutritious pompous meal. #weekendtime #chicken #chickentenders #foodie #foodisart #foodphotography #foodporn #nutrition #bestprotein

Happy Sunday guys❤️Todays dinner is Curried coconut chicken cooked down with some veg and dumplings. Served with rice and peas. —-After cooking the chicken down how I usually do I added 3 big scoops of coconut milk. It definitely gave the chicken that good island taste🤣 and my baby ate off every bone so it pleased everybody 😩 #food #foodie #cooking #homecooking #curriedchicken #coconutmilk #riceandpeasandchicken #cooklikeajamaican #jamaicanfood #foodporn #foodpornography

Nimm Dir Zeit für die Dinge, die Dich glücklich machen ☆ Perfekter Abend mit perfekten Menschen, sind oft die einzige Auszeit die man braucht um wieder Kraft zu tanken ☆ Vielen Dank 😘 • • • • • #thankful #auszeit #entspannen #friends #best #funny #insta #instagood #instafood #picoftheday #instadaily #like #love #essenundgutegesellschaft #follow #foodphoto #foodporn #krafttanken #bruschetta #freundschaft #wochenende #leben #lachen #glücklich #life #

Neue Küche?Gleich mal mit Schatzi eingeweiht 😊😘 Tomaten Zucchini Pesto #leckerundgesund #veganleather #foodporn #zuzweit #kochenistliebe

Närodlad hjortkorv med grillad spetskål och fetaostpaket som fått mysa med på grillen. Extra plus när man känner hon som sköt......korven 😂 När hon dessutom är löpare så är det en bra kvalitetsstämpel. #flexiterian #slickatallriken #jordenruntpå80rätter #världsklass #mums #hållkäftengott #foodporn #food #foodie #mat #instafood #instamat #instafoodie #gott #gottgottigottgott #livetsomengqvist #kämpamickekämpa #nomnom #weightwatchers #gottskitingaben #gottskit #vardagslyx #detskanoghittaröven

#foodporn Jamaican breakfast #mackerelrundown yellow yam, cooked dumplings, fried dumplings, boiled bananas

Mexican Restaurant with one of the biggest traditional brunch selections in Land Park? Get Mexican or American for breakfast, just don't forget our most requested Michelada! . #food #foodporn #yum #instafood #yummy #munchies #amazing #instagood #photooftheday #sweet #dinner #lunch #breakfast #fresh #tasty #food #delish #delicious #eating #foodpic #foodpics #eat #hungry #foodgasm #hot #foods

Teacher becomes student. #happyfathersday

Sexy Queen 🔥😋 omg 49 yr tag a friend 👇 follow me (@jlo.world) for more ♥ • • • • • •Follow (@Jlo.world) me 4 more 🚨 & turn on post notification ❤ • • • • • • #jenniferlopez #jlo #kimkardashian #arianagrande #jrod #khloekardashian #kyliejenner #beyoncé #food #followforfollow #foodporn #follow4follow #followtrain #followshoutoutlikecomment #instagood #instago #instadaily #picsofday #photooftheday #postoftheday #nickiminaj #rihanna #cute @yoncelive #yoncetv #yoncelive #beyonce #formation #beyonceknowles #queenofmusic

In need of a Screaming Orgasm? One of Pubbelly's staple dishes, the Screaming Orgasm is made of seared tuna, spicy ponzu, daikon, and masago roe.

Y’all thought @jdmtsurikawa was only for car design?! Nahhh it even makes food pictures look amazing! 😍❤️ the Tsurikawa is such a nice aesthetic for car pics AND food pics 🔥 go check them out @jdmtsurikawa follow and buy yourselves a Tsurikawa! (From what we heard, they might be popping out some new releases and some ideas in the works 🚗😍) BUT ps: Starbucks is honestly one of our second go to AFTER boba of course 😂 peep the Caramel Crunch Ribbon Frappe left and S’mores frappe right Frappes are amazing for summer time ☀️ . . . . . #food #foody #foodie #foodgasm #foodpics #foodporn #foodphotography #foods #foodlover #foodblogger #foodstagram #foodiegram #foodiesofinstagram #foodblog #instagood #instafood #instafoodie #foodaddict #houston #houstonfoodie #htx #bonappetit #texas #starbucks #coffee #coffeeshop #yum #yummy #study #refresh

Algo dulce de vez en cuando no viene mal. Cupcakes del cumple de Miriam. #cupcake #foodporn #sweet #pink #bakery #dessertgoals

Happy Father’s Day!! 🧡

I was underwhelmed by today’s visit to @gustorestaurants . Visited for brunch to discover they had ran out of a few things on the menu. Coupled with a cold breakfast, other than the sausage. . With a disappointing main, I decided to have some dessert. The tiramisu was very good but I won’t be rushing back here for brunch any time soon. . 📍Cheadle Hulme

¡Nada mejor que compartir la felicidad con los tuyos!❤️ ¡Gracias por la foto!

BROOKLYNS IN THE HOUSE! Love when customers rock our A&S Tee Shirts! Come by and pick one up $25 and grab a FREE Mozzarella‼️ Leave A Comment & Tag A Paisan Bellow🙌🏻 #asfinefoodsmerrick #longisland #newyork 📍Catering From Manhattan To The Hamptons 📍 . . . #eeeeets #foodporn #foodie #food #foodphotography #foodintheair #newforkcity #forkyeah #foodgasm #eating #eatingnyc #cleaneating #foodbeast #buzzfeedfood #eatingfortheinsta #lieats #devourpower #instafood #foodstagram #foodlover #eatnyc #instafood #nycfood #nycfoodie #nycblogger #eatfamous #tastingtable

ЧТО ПРИГОТОВИТЬ??🤔 Я вернулся в Сочи, была насыщенная командировка🔝 Мы сейчас плотно развиваем сеть ресторанов “Chelentano Bar”😎 . Времени готовить практически не было...но сейчас я вернулся в любый Сочи и готов завтра выложить тот Рецепт который ВАМ больше всего интересней 😇 Пиши пожелания в комментариях, а я что нибудь выберу и приготовлю😎 #дорогой_ахмед #рецепты_ахмеда #ешькакахмед #ешь_как_ахмед

J.chefe'
(@j.chefe)

2 Minutes Ago

J.chefe's Asian Cajun Shrimp Po'Boy! 🍤🎯😋 Your Favorite Chefs Favorite Chef!!!!!!!!!! ♥️⚡😍MY COOKBOOK IS OTW! 🙄🍝🍽 🏅Stalk My Food, Talk About My Food, Understand My Food, Embrace My Food! Like My Culinary Page On facebook.com/jchefe247 🤓🔥💯🤗Spread the word about J.chefe' 🔜@foodnetwork 🔪 Follow Me on instagram.com/jchefe247✔🏁🥇🤤 #my #asian #cajun #shrimp #poboy #fusion #um #yum #instagood #lunch #anyone #sandwich #igs #followme #instagram #chefwork #lunchtime #repost #foodpic #foodphotography #food #picoftheday #simply #delicious #people #foodporn #happy #time #chefoftheyear

happy father’s day! made these peanut butter double chocolate chip cookies for my dad today :)

(@maddiepfitlife)

3 Minutes Ago

I don’t know about you but I LOVE sushi. Especially from Whole Foods. That’s where my lunch is from today, the asparagus were burnt tho I could only manage a few before accepting their state. Lol

Indian Spiced Grilled Chicken with Spinach & Mushroom Pilaf. Today I can say I Grilled the perfect chicken! Tender & Juicy to the core.. 🤩🤩 #grilledchicken #healthyfood #healthyfood #food #foodporn #homecook #platingart

🔻🔻🔻 She : Why did you order this? My friend hadn't recommended it He : I've tasted it earlier and I like it. Don't eat if you don't want to. She : Okay now, give me a bite. 🔺🔺🔺 What : Bun gobi with mayonnaise Where : Sadguru Chinese Food Corner Price : Rs.25 Taste : 3.5/5 🔻🔻🔻 #tinditales 🔺🔺🔺

💃🏻🕺🏻

Pastis chocolate crunx, praline d’avellana amb sorbet de Poma verda Dijous 20 de juny maridatge amb @lorangette_reus @olicolldelalba També carta nova amb moltes novetats

(@broke.in)

2 Minutes Ago

So it started raining, but no worries! We stopped by @popbar at the outlets instead. The new roasted marshmallow tastes more like a latte but its still delicious! #brokeinorlando #rainyday #foodporn #icecreampops

O Nobre dando o corte no "steak cowboy"👊🏻🔥🔥🔥🥩🍻🥃! 📸@drsb1989 . @especiariasdaroca @tabuasthe @carvaogoldgrill @emporiumcasanostra @emporiocantagallo . #churrascada #steak #foodporn #food #churras #meat #cerveja #instafood #carnivore #brasil #angus #grilling #meatlovers #gastronomia #ribeye #meatporn #bbqporn #grilled #beef #mioglobina #bbqlife🔥

Thanks @bestwineandfood 🤗🔥 "Plates are full and prices are low 😍.We just loved it ". . . . . . . . . . . . . . . . . . . . #santosha #restaurant #streetfood #thaifood #instafood #foodlover #food #foodporn #foodstagram #santoshanantes #nantes #bordeaux #bordeauxmaville #rice #toulouse #santoshatoulouse #talence #homemade #faitmaison

This is the most important part of my story. Read it till the end.✌🏻It's about my job life though. Likewise this journey towards swat/kalam, daily when i travel for my job random thoughts came into my conscious mind. . This is here the topic goes on: *Change* is the only *constant* in Nature and the Universe, yet guys we people are SO resistant to change. (for sure I'm talking about myself first and before)🙌🏻 Mai jahan b hun, while travel, in home, anywhere its the damn truth; EVERY MONTH it's like I START all over again. What do I mean by that??? So truth be told. I no longer yaar, I no longer set goals for myself. Instead I ask what Allah wants me to experience? Maybe A Higher Purpose bigger than me. So strategies no longer works for me. Because what got me Here WON'T get me there. I believe.😊 From the past so many days I was so scared of change and yeah starting over. I discussed it with 2,3 people too. I don't want to change my job. Till it no longer serves me.(clearly not talking about money) It looks like a fantastic idea but it's like a death to the soul. Here's is the ANSWER!! 👇🏻 The soul is Only seeking growth and expansion. It DOESN'T CARE ABOUT success & money. (I swear) I'm not after earning money. I repeat I AM NOT!!! Every month I check up to myself to see if what used to light me up is lightening me up anymore or not. If not, then I simply check in to see what is it that I would like to create. This is what I actually care about for myself. Money is never my thing. I believe in growth, and growth is MY DEAR Ones, GROWTH IS NOT ABOUT MONEY. Break this stereotypical thinking we've created. Kitni pay Hai? Oh 15, 20? For this is you're going for another city? Please! Change this concept of growth. If you're learning anything, if you're achieving anything it's the real growth for you, for dearest soul. . . PS I was on my way to kalam. 😍 The exact location was katlang Khyber pakhtunkhwa. . . Follow @theoutdoorhuman for more.♥️ . . Share your thoughts. 🙌🏻 اَلْحَمْدُ لِلّٰهِ

(@ss._.ollllll)

7 Hours Ago

좋군~~🍀

Sunday's best for all the fathers out there like me, BEEF SINIGANG!!! #sinigang #pinoyfood #mgalutuinatfoodtripniphatypogi #mgalutuinniphaty

Wonderful dinner in #yeg #yeglife #yegeats #foodporn . - spicy Old fashion 🥃 - beef #tartare 🐮 - kitchen board 🍖 - rib eye 🥩 All is very good! 👍🏻😆

Bacs
(@mary.xx1315)

4 Days 14 Hours Ago

Pinay sa puso’t diwa! 🇵🇭 #maligayangarawngkalayaanpilipinas🇵🇭

Bacs
(@mary.xx1315)

6 Days 3 Hours Ago

Hundred folds of blessings, happiness appears on my soul, it makes me aged like a fine wine they said. Happy at my 30s. Life is so beautiful to get insecure to witches soul❤️🍷💋🧜‍♀️ #lovinggypsytribe💕

Bacs
(@mary.xx1315)

7 Days 2 Hours Ago

Medium rare and beer as hangover quencher. ☠️ . . . Thanks moder for my see through skull top. (Anything with skull, binibili nya sakin kahit matanda na ko. Knows na knows nya talaga me 😬)